Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMZNPTY)

• DOT Name: Transcription elongation factor A protein-like 6 (TCEAL6)
• Synonyms: TCEA-like protein 6; Transcription elongation factor S-II protein-like 6
• Gene Name: TCEAL6
• UniProt ID: TCAL6_HUMAN
• Pfam ID: PF04538
• Sequence:
  MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDAEGKTECEGKRKAEGEPGDEGQL
  EDKGSQEKQGKSEGEGKPQGEGKPASQAKPEGQPRAAEKRPAGDYVPRKAKRKTDRGTDD
  SPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRG
  VRGVRGGGRGQRGLHDIPYL
• Function: May be involved in transcriptional regulation.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transcription elongation factor A protein-like 6 (TCEAL6).	[1]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Transcription elongation factor A protein-like 6 (TCEAL6).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transcription elongation factor A protein-like 6 (TCEAL6).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transcription elongation factor A protein-like 6 (TCEAL6).	[3]

References

• [1] Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
• [2] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.