Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN7G8V1)

• DOT Name: Melanoma-associated antigen B1 (MAGEB1)
• Synonyms: Cancer/testis antigen 3.1; CT3.1; DSS-AHC critical interval MAGE superfamily 10; DAM10; MAGE-B1 antigen; MAGE-XP antigen
• Gene Name: MAGEB1
• Related Disease:
  Lung neoplasm
  Melanoma
  X-linked adrenal hypoplasia congenita
• UniProt ID: MAGB1_HUMAN
• PDB ID: 6R7T
• Pfam ID: PF01454 ; PF12440
• Sequence:
  MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQK
  PQGAPPTTTAAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFIL
  RKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSK
  LNLTNDGNLSNDWDFPRNGLLMPLLGVIFLKGNSATEEEIWKFMNVLGAYDGEEHLIYGE
  PRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF
  PSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSHPM
• Tissue Specificity: Expressed only in testis.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung neoplasm	DISVARNB	Strong	Altered Expression	[1]
Melanoma	DIS1RRCY	Strong	Altered Expression	[2]
X-linked adrenal hypoplasia congenita	DISNMXY8	Limited	Genetic Variation	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Melanoma-associated antigen B1 (MAGEB1).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Melanoma-associated antigen B1 (MAGEB1).	[5]

References

• [1] A family of rapidly evolving genes from the sex reversal critical region in Xp21.Mamm Genome. 1995 Sep;6(9):571-80. doi: 10.1007/BF00352360.
• [2] Hypertonicity induction of melanoma antigen, a tumor-associated antigen.Mol Cells. 2002 Apr 30;13(2):288-95.
• [3] Isolation and characterization of a MAGE gene family in the Xp21.3 region.Proc Natl Acad Sci U S A. 1995 May 23;92(11):4987-91. doi: 10.1073/pnas.92.11.4987.
• [4] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.