Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNHGXIS)

• DOT Name: Putative P2Y purinoceptor 10 (P2RY10)
• Synonyms: P2Y10; P2Y-like receptor
• Gene Name: P2RY10
• UniProt ID: P2Y10_HUMAN
• Pfam ID: PF00001
• Sequence:
  MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLC
  RFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYAS
  ICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKS
  CFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQK
  ALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLL
  DPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
• Function: Putative receptor for purines coupled to G-proteins.
• Tissue Specificity: Weakly expressed in blood leukocytes.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  P2Y receptors (R-HSA-417957)
  G alpha (q) signalling events (R-HSA-416476)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Putative P2Y purinoceptor 10 (P2RY10).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Putative P2Y purinoceptor 10 (P2RY10).	[4]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Putative P2Y purinoceptor 10 (P2RY10).	[6]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Putative P2Y purinoceptor 10 (P2RY10).	[2]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Putative P2Y purinoceptor 10 (P2RY10).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Putative P2Y purinoceptor 10 (P2RY10).	[5]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [3] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [6] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.