Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNJEZC0)

DOT Name	Complement C1q and tumor necrosis factor-related protein 9B (C1QTNF9B)
Synonyms	C1q/TNF-related protein 9B; CTRP9B; Complement C1q and tumor necrosis factor-related protein 9-like
Gene Name	C1QTNF9B
Related Disease	Advanced cancer ( )
UniProt ID	C1T9B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00386 ; PF01391
Sequence	MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGC PGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGP QGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGI RGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAVGK FTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTRDAYVSSEDQASGSIVLQLKLGDE MWLQVTGGERFNGLFADEDDDTTFTGFLLFSSQ
Function	Probable adipokine. Activates AMPK, AKT, and p44/42 MAPK signaling pathways.
Tissue Specificity	Expressed at low levels. Not expressed in adipose tissues.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Complement C1q and tumor necrosis factor-related protein 9B (C1QTNF9B).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Complement C1q and tumor necrosis factor-related protein 9B (C1QTNF9B).	[3]
------------------------------------------------------------------------------------

References

1	CTHRC1 overexpression predicts poor survival and enhances epithelial-mesenchymal transition in colorectal cancer.Cancer Med. 2018 Nov;7(11):5643-5654. doi: 10.1002/cam4.1807. Epub 2018 Oct 9.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
3	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.