Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNONJST)

• DOT Name: Sperm acrosome developmental regulator (SPACDR)
• Gene Name: SPACDR
• UniProt ID: SACDR_HUMAN
• Pfam ID: PF15775
• Sequence:
  MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLV
  ELPKEAKPKLGESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQ
  SGWQMCSWKSSVSSASVSSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHR
  RHHVRCHAAPRPNPAQSLKLDAQSPL
• Function: May play a role in acrosome formation and nucleus shaping during spermiogenesis.
• Tissue Specificity: Expressed in sperm (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Sperm acrosome developmental regulator (SPACDR).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Sperm acrosome developmental regulator (SPACDR).	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Sperm acrosome developmental regulator (SPACDR).	[2]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.