Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTNOW66C)
| DOT Name | C-type lectin domain family 12 member B (CLEC12B) | ||||
|---|---|---|---|---|---|
| Synonyms | Macrophage antigen H | ||||
| Gene Name | CLEC12B | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTL
GMMFLQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQ EQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLV KIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLFSTKELDQINGSK GCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD |
||||
| Function |
Inhibitory receptor postulated to negatively regulate immune and non-immune functions. Upon phosphorylation, recruits SH2 domain-containing PTPN6 and PTPN11 phosphatases to its ITIM motif and antagonizes activation signals. Although it inhibits KLRK1/NKG2D-mediated signaling, it does not bind known ligands of KLRK1/NKG2D and therefore is not its inhibitory counterpart. May limit activation of myeloid cell subsets in response to infection or tissue inflammation. May protect target cells against natural killer cell-mediated lysis. May negatively regulate cell cycle and differentiation of melanocytes via inactivation of STAT3.
|
||||
| Tissue Specificity | Detected in colon, heart, kidney, liver, lung, mammary gland, ovary, spleen and testis . Expressed in melanocytes (at protein level) . | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||
References
