Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNQIVOJ)

DOT Name Ret finger protein-like 1 (RFPL1)
Synonyms RING finger protein 78
Gene Name RFPL1
Related Disease
Head-neck squamous cell carcinoma ( )
UniProt ID
RFPL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13765 ; PF11002 ; PF00622 ; PF15227
Sequence
MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVC
FKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRM
RKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRH
YWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDR
KLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICP
VINPGTTDAPVHPGEAK
Function Negatively regulates the G2-M phase transition, possibly by promoting cyclin B1/CCNB1 and CDK1 proteasomal degradation and thereby preventing their accumulation during interphase.
Tissue Specificity Seems to be expressed in prostate and less abundantly in adult brain, fetal liver, and fetal kidney.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Head-neck squamous cell carcinoma DISF7P24 moderate Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Ret finger protein-like 1 (RFPL1). [2]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Ret finger protein-like 1 (RFPL1). [3]
Testosterone DM7HUNW Approved Testosterone increases the expression of Ret finger protein-like 1 (RFPL1). [3]
------------------------------------------------------------------------------------

References

1 A six-mRNA prognostic model to predict survival in head and neck squamous cell carcinoma.Cancer Manag Res. 2018 Dec 20;11:131-142. doi: 10.2147/CMAR.S185875. eCollection 2019.
2 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
3 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.