Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNR1V9T)

DOT Name	Cancer/testis antigen family 45 member A5 (CT45A10)
Synonyms	Cancer/testis antigen 45-5; Cancer/testis antigen 45A5
Gene Name	CT45A10
UniProt ID	CT455_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15300
Sequence	MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT GHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH LKKKLKRMI
Tissue Specificity	Testis specific. Expressed in cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cancer/testis antigen family 45 member A5 (CT45A10).	[1]
------------------------------------------------------------------------------------

References

1	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.