Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNWICHJ)

DOT Name	Ras-related protein Rab-9B (RAB9B)
Synonyms	Rab-9-like protein; Rab-9L
Gene Name	RAB9B
UniProt ID	RAB9B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2OCB
Pfam ID	PF00071
Sequence	MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQI WDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFV VLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLE HCMLGHTIDLNSGSKAGSSCC
Function	Involved in the transport of proteins between the endosomes and the trans Golgi network.
Tissue Specificity	Ubiquitous.
KEGG Pathway	Salmonella infection (hsa05132 ) Measles (hsa05162 )
Reactome Pathway	Retrograde transport at the Trans-Golgi-Network (R-HSA-6811440 ) RAB geranylgeranylation (R-HSA-8873719 ) RAB GEFs exchange GTP for GDP on RABs (R-HSA-8876198 ) RHOBTB3 ATPase cycle (R-HSA-9706019 ) Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Ras-related protein Rab-9B (RAB9B).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ras-related protein Rab-9B (RAB9B).	[7]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Ras-related protein Rab-9B (RAB9B).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Ras-related protein Rab-9B (RAB9B).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ras-related protein Rab-9B (RAB9B).	[4]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Ras-related protein Rab-9B (RAB9B).	[5]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Ras-related protein Rab-9B (RAB9B).	[6]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5	Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
6	Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.