Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNZPWWL)

DOT Name	Ribonuclease P protein subunit p30 (RPP30)
Synonyms	RNaseP protein p30; RNase P subunit 2
Gene Name	RPP30
UniProt ID	RPP30_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	6AHR; 6AHU
Pfam ID	PF01876
Sequence	MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTT LPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHL DVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLMQIC KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG IISTVKKPRPSEGDEDCLPASKKAKCEG
Function	Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.
KEGG Pathway	Ribosome biogenesis in eukaryotes (hsa03008 )
Reactome Pathway	Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 ) tRNA processing in the nucleus (R-HSA-6784531 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Ribonuclease P protein subunit p30 (RPP30).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ribonuclease P protein subunit p30 (RPP30).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Ribonuclease P protein subunit p30 (RPP30).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ribonuclease P protein subunit p30 (RPP30).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ribonuclease P protein subunit p30 (RPP30).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Ribonuclease P protein subunit p30 (RPP30).	[6]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Ribonuclease P protein subunit p30 (RPP30).	[7]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Ribonuclease P protein subunit p30 (RPP30).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

References

1	Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
7	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
8	Transcriptomic alterations induced by Ochratoxin A in rat and human renal proximal tubular in vitro models and comparison to a rat in vivo model. Arch Toxicol. 2012 Apr;86(4):571-89.