Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO2FEXF)

DOT Name	Interferon alpha-10 (IFNA10)
Synonyms	IFN-alpha-10; Interferon alpha-6L; Interferon alpha-C; LeIF C
Gene Name	IFNA10
Related Disease	Crohn disease ( ) Sarcoidosis ( ) Neoplasm ( )
UniProt ID	IFN10_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00143
Sequence	MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFR IPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTN LQKRLRRKD
Function	Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) PI3K-Akt sig.ling pathway (hsa04151 ) Necroptosis (hsa04217 ) Toll-like receptor sig.ling pathway (hsa04620 ) NOD-like receptor sig.ling pathway (hsa04621 ) RIG-I-like receptor sig.ling pathway (hsa04622 ) Cytosolic D.-sensing pathway (hsa04623 ) JAK-STAT sig.ling pathway (hsa04630 ) .tural killer cell mediated cytotoxicity (hsa04650 ) Alcoholic liver disease (hsa04936 ) Tuberculosis (hsa05152 ) Hepatitis C (hsa05160 ) Hepatitis B (hsa05161 ) Measles (hsa05162 ) Human cytomegalovirus infection (hsa05163 ) Influenza A (hsa05164 ) Human papillomavirus infection (hsa05165 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Herpes simplex virus 1 infection (hsa05168 ) Epstein-Barr virus infection (hsa05169 ) Human immunodeficiency virus 1 infection (hsa05170 ) Coro.virus disease - COVID-19 (hsa05171 ) Pathways in cancer (hsa05200 ) Autoimmune thyroid disease (hsa05320 ) Lipid and atherosclerosis (hsa05417 )
Reactome Pathway	Regulation of IFNA/IFNB signaling (R-HSA-912694 ) TRAF6 mediated IRF7 activation (R-HSA-933541 ) SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 ) Factors involved in megakaryocyte development and platelet production (R-HSA-983231 ) Interferon alpha/beta signaling (R-HSA-909733 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Crohn disease	DIS2C5Q8	Strong	Genetic Variation	[1]
Sarcoidosis	DISE5B8Z	Strong	Genetic Variation	[2]
Neoplasm	DISZKGEW	Limited	Altered Expression	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Selenium	DM25CGV	Approved	Selenium decreases the expression of Interferon alpha-10 (IFNA10).	[4]
------------------------------------------------------------------------------------

References

1	Exome sequencing identifies novel compound heterozygous IFNA4 and IFNA10 mutations as a cause of impaired function in Crohn's disease patients.Sci Rep. 2015 May 22;5:10514. doi: 10.1038/srep10514.
2	Cystic fibrosis conductance regulator, tumor necrosis factor, interferon alpha-10, interferon alpha-17, and interferon gamma genotyping as potential risk markers in pulmonary sarcoidosis pathogenesis in Greek patients.Genet Test Mol Biomarkers. 2010 Aug;14(4):577-84. doi: 10.1089/gtmb.2009.0198.
3	Treatment with low-dose interferon-alpha restores the balance between matrix metalloproteinase-9 and E-cadherin expression in human transitional cell carcinoma of the bladder.Clin Cancer Res. 2001 Sep;7(9):2840-53.
4	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.