Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO605LY)

DOT Name Lysozyme-like protein 4 (LYZL4)
Synonyms Lysozyme-4
Gene Name LYZL4
Related Disease
Alzheimer disease ( )
UniProt ID
LYZL4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00062
Sequence
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTREGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
MGAWPTWSRYCQYSDTLARWLDGCKL
Function May be involved in fertilization. Has no detectable bacteriolytic and lysozyme activities in vitro.
Tissue Specificity Expressed in testis and epididymis.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Lysozyme-like protein 4 (LYZL4). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Lysozyme-like protein 4 (LYZL4). [4]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Lysozyme-like protein 4 (LYZL4). [3]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Lysozyme-like protein 4 (LYZL4). [5]
------------------------------------------------------------------------------------

References

1 Beneficial effects of increased lysozyme levels in Alzheimer's disease modelled in Drosophila melanogaster.FEBS J. 2016 Oct;283(19):3508-3522. doi: 10.1111/febs.13830.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.