Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTOVWYL9)
| DOT Name | Keratin-associated protein 5-2 (KRTAP5-2) | ||||
|---|---|---|---|---|---|
| Synonyms | Keratin-associated protein 5-8; Keratin-associated protein 5.2; Keratin-associated protein 5.8; Ultrahigh sulfur keratin-associated protein 5.2 | ||||
| Gene Name | KRTAP5-2 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MGCCGCSRGCGSGCGGCGSSCGGCGSGCGGCGSGRGGCGSGCGGCSSSCGGCGSRCYVPV
CCCKPVCSWVPACSCTSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQSSCCK PCCCSSGCGSSCCQSSCCKPCCCQSSCCVPVCCQSSCCKPCCCQSNCCVPVCCQCKI |
||||
| Function |
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
|
||||
| Tissue Specificity | Restricted to hair root, not detected in any other tissues. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
References
