Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTP146P1)
DOT Name | P2Y purinoceptor 13 (P2RY13) | ||||
---|---|---|---|---|---|
Synonyms | P2Y13; G-protein coupled receptor 86; G-protein coupled receptor 94 | ||||
Gene Name | P2RY13 | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGIL
LNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSS VIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTI LSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYR KSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKE TTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG |
||||
Function | Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system. | ||||
Tissue Specificity |
Strong expression in spleen and adult brain. Lower expression in placenta, lung, liver, spinal cord, thymus, small intestine, uterus, stomach, testis, fetal brain, and adrenal gland. Not detected in pancreas, heart, kidney, skeletal muscle, ovary or fetal aorta. Clearly detected in lymph node and bone marrow, weakly detected in peripheral blood mononuclear cells (PBMC) and in peripheral blood leukocytes (PBL), but not detected in polymorphonuclear cells (PMN). In the brain, detected in all brain regions examined.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
References