Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP5YU8J)

DOT Name	Germ cell-specific gene 1-like protein (GSG1L)
Synonyms	GSG1-like protein
Gene Name	GSG1L
Related Disease	Neoplasm ( )
UniProt ID	GSG1L_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07803
Sequence	MKTSRRGRALLAVALNLLALLFATTAFLTTHWCQGTQRVPKPGCGQGGRANCPNSGANAT ANGTAAPAAAAAAATASGNGPPGGALYSWETGDDRFLFRNFHTGIWYSCEEELSGLGEKC RSFIDLAPASEKGVLWLSVVSEVLYILLLVVGFSLMCLELFHSSNVIDGLKLNAFAAVFT VLSGLLGMVAHMMYTQVFQVTVSLGPEDWRPHSWDYGWSFCLAWGSFTCCMAASVTTLNS YTKTVIEFRHKRKVFEQGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPAR HQPHMADSWPRSSAQEAPELNRQCWVLGHWV
Function	As a component of the inner core of AMPAR complex, modifies AMPA receptor (AMPAR) gating.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Neoplasm	DISZKGEW	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Germ cell-specific gene 1-like protein (GSG1L).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Germ cell-specific gene 1-like protein (GSG1L).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Germ cell-specific gene 1-like protein (GSG1L).	[3]
------------------------------------------------------------------------------------

References

1	Hyper-Methylated Loci Persisting from Sessile Serrated Polyps to Serrated Cancers.Int J Mol Sci. 2017 Mar 2;18(3):535. doi: 10.3390/ijms18030535.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.