General Information of Drug Off-Target (DOT) (ID: OTP6L08T)

DOT Name 5-hydroxytryptamine receptor 3D (HTR3D)
Synonyms 5-HT3-D; 5-HT3D; Serotonin receptor 3D
Gene Name HTR3D
Related Disease
Angle-closure glaucoma ( )
Obsessive compulsive disorder ( )
Primary angle-closure glaucoma ( )
Schizophrenia ( )
Stroke ( )
UniProt ID
5HT3D_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02931 ; PF02932
Sequence
MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS
VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS
DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS
FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS
GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM
QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP
TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT
Function Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.
Tissue Specificity Expressed in liver, as well as fetal and adult colon and kidney.
KEGG Pathway
Serotonergic sy.pse (hsa04726 )
Taste transduction (hsa04742 )
Reactome Pathway
Neurotransmitter receptors and postsynaptic signal transmission (R-HSA-112314 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Angle-closure glaucoma DISZ95KY Strong Genetic Variation [1]
Obsessive compulsive disorder DIS1ZMM2 Strong Genetic Variation [2]
Primary angle-closure glaucoma DISX8UKZ Strong Genetic Variation [1]
Schizophrenia DISSRV2N Strong Biomarker [3]
Stroke DISX6UHX Limited Biomarker [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of 5-hydroxytryptamine receptor 3D (HTR3D). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of 5-hydroxytryptamine receptor 3D (HTR3D). [6]
------------------------------------------------------------------------------------

References

1 Genetic Association of the PARL-ABCC5-HTR3D-HTR3C Locus With Primary Angle-Closure Glaucoma in Chinese.Invest Ophthalmol Vis Sci. 2017 Aug 1;58(10):4384?389. doi: 10.1167/iovs.17-22304.
2 5-HT3 receptor influences the washing phenotype and visual organization in obsessive-compulsive disorder supporting 5-HT3 receptor antagonists as novel treatment option.Eur Neuropsychopharmacol. 2014 Jan;24(1):86-94. doi: 10.1016/j.euroneuro.2013.07.003. Epub 2013 Aug 6.
3 A coding variant of the novel serotonin receptor subunit 5-HT3E influences sustained attention in schizophrenia patients.Eur Neuropsychopharmacol. 2010 Jun;20(6):414-20. doi: 10.1016/j.euroneuro.2010.02.012. Epub 2010 Mar 30.
4 Novel susceptibility genes were found in a targeted sequencing of stroke patients with or without depression in the Chinese Han population.J Affect Disord. 2019 Aug 1;255:1-9. doi: 10.1016/j.jad.2019.05.023. Epub 2019 May 13.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.