Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP98X7P)

DOT Name Sperm protein associated with the nucleus on the X chromosome N3 (SPANXN3)
Synonyms Nuclear-associated protein SPAN-Xn3; SPANX-N3; SPANX family member N3
Gene Name SPANXN3
UniProt ID
SPXN3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07458
Sequence
MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKNTKTSEYPIIFVYYLRKG
KKINSNQLENEQSQENSINPIQKEEDEGVDLSEGSSNEDEDLGPCEGPSKEDKDLDSSEG
SSQEDEDLGLSEGSSQDSGED

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Sperm protein associated with the nucleus on the X chromosome N3 (SPANXN3). [1]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Sperm protein associated with the nucleus on the X chromosome N3 (SPANXN3). [2]
Malathion DMXZ84M Approved Malathion decreases the expression of Sperm protein associated with the nucleus on the X chromosome N3 (SPANXN3). [3]
------------------------------------------------------------------------------------

References

1 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
2 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
3 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.