Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ1MHRJ)

DOT Name	Olfactory receptor 51B5 (OR51B5)
Synonyms	Odorant receptor HOR5'beta5; Olfactory receptor OR11-37
Gene Name	OR51B5
Related Disease	Malaria ( ) Sickle-cell anaemia ( )
UniProt ID	O51B5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13853
Sequence	MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKEDHNLHEPMYFF LAMLAATDLGLALTTMPTVLGVLWLDHREIGSAACFSQAYFIHSLSFLESGILLAMAYDR FIAICNPLRYTSVLTNTRVVKIGLGVLMRGFVSVVPPIRPLYFFLYCHSHVLSHAFCLHQ DVIKLACADTTFNRLYPAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCV SHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLIMSYAYFLFPPLMNPITYSVKTKQIQNA ILHLFTTHRIGT
Function	Odorant receptor.
KEGG Pathway	Olfactory transduction (hsa04740 )
Reactome Pathway	Expression and translocation of olfactory receptors (R-HSA-9752946 ) Olfactory Signaling Pathway (R-HSA-381753 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Malaria	DISQ9Y50	Strong	Genetic Variation	[1]
Sickle-cell anaemia	DIS5YNZB	Strong	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Olfactory receptor 51B5 (OR51B5).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Olfactory receptor 51B5 (OR51B5).	[4]
------------------------------------------------------------------------------------

References

1	Genome-wide association study indicates two novel resistance loci for severe malaria.Nature. 2012 Sep 20;489(7416):443-6. doi: 10.1038/nature11334. Epub 2012 Aug 15.
2	Genetic determinants of haemolysis in sickle cell anaemia.Br J Haematol. 2013 Apr;161(2):270-8. doi: 10.1111/bjh.12245. Epub 2013 Feb 14.
3	Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.