Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ4WS0O)

• DOT Name: Neurotensin receptor type 2 (NTSR2)
• Synonyms: NT-R-2; NTR2; Levocabastine-sensitive neurotensin receptor
• Gene Name: NTSR2
• UniProt ID: NTR2_HUMAN
• Pfam ID: PF00001
• Sequence:
  METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKA
  RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY
  ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL
  ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV
  PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
  AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA
  VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
• Function: Receptor for the tridecapeptide neurotensin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
• Tissue Specificity: Expressed in prostate (at protein level).
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Peptide ligand-binding receptors (R-HSA-375276)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Neurotensin receptor type 2 (NTSR2).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Neurotensin receptor type 2 (NTSR2).	[2]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
NEUROTENSIN	DM27WCE	Investigative	NEUROTENSIN affects the binding of Neurotensin receptor type 2 (NTSR2).	[3]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] NT79: A novel neurotensin analog with selective behavioral effects. Brain Res. 2010 Jan 13;1308:35-46. doi: 10.1016/j.brainres.2009.10.050. Epub 2009 Oct 27.