Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQCIJ4U)

• DOT Name: Methyl-CpG-binding domain protein 3-like 1 (MBD3L1)
• Synonyms: MBD3-like protein 1
• Gene Name: MBD3L1
• Related Disease: facioscapulohumeral muscular dystrophy
• UniProt ID: MB3L1_HUMAN
• Pfam ID: PF14048 ; PF16564
• Sequence:
  MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLE
  KPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMP
  HLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANE
  AEKVRDQEGRPEKR
• Function: Transcriptional repressor.
• Tissue Specificity: Highly expressed in testis. Detected at low levels in pancreas. Not detected in the other tissues tested.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
facioscapulohumeral muscular dystrophy	DISSE0H0	Limited	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Methyl-CpG-binding domain protein 3-like 1 (MBD3L1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Methyl-CpG-binding domain protein 3-like 1 (MBD3L1).	[3]

References

• [1] NuRD and CAF-1-mediated silencing of the D4Z4 array is modulated by DUX4-induced MBD3L proteins.Elife. 2018 Mar 13;7:e31023. doi: 10.7554/eLife.31023.
• [2] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.