Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQCYD1Q)

• DOT Name: FHF complex subunit HOOK interacting protein 2A (FHIP2A)
• Synonyms: FHIP2A
• Gene Name: FHIP2A
• UniProt ID: FHI2A_HUMAN
• Pfam ID: PF19314 ; PF19311 ; PF10257
• Sequence:
  MFSKFTSILQHAVEALAPSLPLQEDFVYHWKAITHYYIETSDDKAPVTDTNIPSHLEQML
  DILVQEENERESGETGPCMEYLLHHKILETLYTLGKADCPPGMKQQVLVFYTKLLGRIRQ
  PLLPHINVHRPVQKLIRLCGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSL
  ASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHLSTSLD
  NLSVTSLPEASVVCPNQDYNLVNSLLNLTRSPDGRIAVKACEGLMLLVSLPEPAAAKCLT
  QSTCLCELLTDRLASLYKALPQSVDPLDIETVEAINWGLDSYSHKEDASAFPGKRALISF
  LSWFDYCDQLIKEAQKTAAVALAKAVHERFFIGVMEPQLMQTSEMGILTSTALLHRIVRQ
  VTSDVLLQEMVFFILGEQREPETLAEISRHPLRHRLIEHCDHISDEISIMTLRMFEHLLQ
  KPNEHILYNLVLRNLEERNYTEYKPLCPEDKDVVENGLIAGAVDLEEDPLFTDISPENTL
  PNQEWLSSSPPATPDHPKNDGKTEVHKIVNSFLCLVPDDAKSSYHVEGTGYDTYLRDAHR
  QFRDYCAICLRWEWPGSPKALEKCNLEAAFFEGHFLKVLFDRMGRILDQPYDVNLQVTSV
  LSRLSLFPHPHIHEYLLDPYVNLAPGCRSLFSVIVRVVGDLMLRIQRIQDFTPKLLLVRK
  RLLGLEPEGPIIDHITLLEGVIVLEEFCKELAAIAFVKYHASSTP
• Function: Required for proper functioning of the nervous system.
• Tissue Specificity: .Expressed in all tissues tested, highly expressed brain.; [Isoform 2]: Only detected at high levels in testis.

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of FHF complex subunit HOOK interacting protein 2A (FHIP2A).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of FHF complex subunit HOOK interacting protein 2A (FHIP2A).	[2]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of FHF complex subunit HOOK interacting protein 2A (FHIP2A).	[3]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of FHF complex subunit HOOK interacting protein 2A (FHIP2A).	[4]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of FHF complex subunit HOOK interacting protein 2A (FHIP2A).	[7]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of FHF complex subunit HOOK interacting protein 2A (FHIP2A).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of FHF complex subunit HOOK interacting protein 2A (FHIP2A).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.