Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQD8S4N)

• DOT Name: Recombining binding protein suppressor of hairless-like protein (RBPJL)
• Synonyms: Transcription factor RBP-L
• Gene Name: RBPJL
• Related Disease:
  Non-insulin dependent diabetes
  Type-1/2 diabetes
• UniProt ID: RBPJL_HUMAN
• Pfam ID: PF09270 ; PF09271 ; PF20144
• Sequence:
  MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
  LQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTV
  CGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRE
  LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
  SARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
  LDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
  IIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV
  EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYS
  VRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT
• Function: Putative transcription factor, which cooperates with EBNA2 to activate transcription.
• KEGG Pathway:
  Notch sig.ling pathway (hsa04330)
  Th1 and Th2 cell differentiation (hsa04658)
  Spinocerebellar ataxia (hsa05017)
  Human papillomavirus infection (hsa05165)
  Epstein-Barr virus infection (hsa05169)
  Viral carcinogenesis (hsa05203)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[1]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Recombining binding protein suppressor of hairless-like protein (RBPJL).	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Recombining binding protein suppressor of hairless-like protein (RBPJL).	[3]

References

• [1] Functional and association analysis of an Amerindian-derived population-specific p.(Thr280Met) variant in RBPJL, a component of the PTF1 complex.Eur J Hum Genet. 2018 Feb;26(2):238-246. doi: 10.1038/s41431-017-0062-6. Epub 2018 Jan 4.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.