Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQE62ZB)

• DOT Name: Retrotransposon Gag-like protein 4 (RTL4)
• Synonyms: Mammalian retrotransposon-derived protein 4; Zinc finger CCHC domain-containing protein 16
• Gene Name: RTL4
• Related Disease: Blast phase chronic myelogenous leukemia, BCR-ABL1 positive
• UniProt ID: RTL4_HUMAN
• Sequence:
  MEKCTKSSSTMQVEPSFLQAENLILRLQMQHPTTENTAKRGQVMPALATTVMPVPYSLEH
  LTQFHGDPANCSEFLTQVTTYLTALQISNPANDAQIKLFFDYLSQQLESCGIISGPDKST
  LLKQYENLILEFQQSFGKPTKQEINPLMNAKFDKGDNSSQQDPATFHLLAQNLICNETNQ
  SGQFEKALADPNQDEESVTDMMDNLPDLITQCIQLDKKHSDRPELLQSETQLPLLASLIQ
  HQALFSPTDPPPKKGPIQLREGQLPLTPAKRARQQETQLCLYCSQSGHFTRDCLAKRSRA
  PATTNNTAHQ
• Function: Involved in cognitive function in the brain, possibly via the noradrenergic system.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive	DIS3KLUX	Definitive	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Retrotransposon Gag-like protein 4 (RTL4).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Retrotransposon Gag-like protein 4 (RTL4).	[3]

References

• [1] Emergence of a cell line with extreme hypodiploidy in blast crisis of chronic myelocytic leukemia.Blood. 1979 Apr;53(4):707-11.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.