Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQG5Z82)

DOT Name Lengsin (LGSN)
Synonyms Glutamate-ammonia ligase domain-containing protein 1; Lens glutamine synthase-like
Gene Name LGSN
Related Disease
Juvenile myoclonic epilepsy ( )
LennoxGastaut syndrome ( )
Trichorhinophalangeal syndrome type II ( )
Cornelia de Lange syndrome 4 ( )
Epilepsy ( )
Lung cancer ( )
Lung carcinoma ( )
Mucopolysaccharidosis type 4A ( )
Neoplasm ( )
Retinitis pigmentosa 25 ( )
UniProt ID
LGSN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00120
Sequence
MNNEEDLLQEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMRDS
SQILTPPQLSSRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMP
RGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPL
LTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPALTFLNNHDQPFM
QELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIA
SFFIETGFCDSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMA
PSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL
AATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETF
IRYFVAMKKYELENEEIAAERNKFLEYFI
Function
May act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity.
Tissue Specificity Abundantly expressed in lens.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Juvenile myoclonic epilepsy DISYXV1N Definitive Genetic Variation [1]
LennoxGastaut syndrome DISOTGO5 Definitive Genetic Variation [1]
Trichorhinophalangeal syndrome type II DISW4YZ1 Definitive Genetic Variation [1]
Cornelia de Lange syndrome 4 DISXRJCA Strong Genetic Variation [2]
Epilepsy DISBB28L Strong Biomarker [3]
Lung cancer DISCM4YA Strong Genetic Variation [4]
Lung carcinoma DISTR26C Strong Genetic Variation [4]
Mucopolysaccharidosis type 4A DISTYFQS Strong Biomarker [5]
Neoplasm DISZKGEW Strong Biomarker [4]
Retinitis pigmentosa 25 DISTIKZB Strong Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Lengsin (LGSN). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Lengsin (LGSN). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Lengsin (LGSN). [9]
Menadione DMSJDTY Approved Menadione affects the expression of Lengsin (LGSN). [9]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Lengsin (LGSN). [11]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Lengsin (LGSN). [10]
------------------------------------------------------------------------------------

References

1 Association of GABAA Receptor Gene with Epilepsy Syndromes.J Mol Neurosci. 2018 Jun;65(2):141-153. doi: 10.1007/s12031-018-1081-7. Epub 2018 May 21.
2 Prenatal diagnosis and array comparative genomic hybridization characterization of interstitial deletions of 8q23.3-q24.11 and 8q24.13 associated with Langer-Giedion syndrome, Cornelia de Lange syndrome and haploinsufficiency of TRPS1, RAD21 and EXT1.Taiwan J Obstet Gynecol. 2015 Oct;54(5):592-6. doi: 10.1016/j.tjog.2015.08.013.
3 Pathogenesis of Lennox-Gastaut syndrome: considerations and hypotheses.Epileptic Disord. 2001 Dec;3(4):183-96.
4 Novel spliced form of a lens protein as a novel lung cancer antigen, Lengsin splicing variant 4.Cancer Sci. 2009 Aug;100(8):1485-93. doi: 10.1111/j.1349-7006.2009.01187.x. Epub 2009 May 19.
5 Various cells retrovirally transduced with N-acetylgalactosoamine-6-sulfate sulfatase correct Morquio skin fibroblasts in vitro.Hum Gene Ther. 2001 Nov 1;12(16):2007-16. doi: 10.1089/104303401753204571.
6 Mutation screening of three candidate genes, ELOVL5, SMAP1 and GLULD1 in autosomal recessive retinitis pigmentosa.Int J Mol Med. 2005 Dec;16(6):1163-7.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.