Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR7MT1E)

• DOT Name: Keratin, type I cytoskeletal 24 (KRT24)
• Synonyms: Cytokeratin-24; CK-24; Keratin-24; K24; Type I keratin-24
• Gene Name: KRT24
• UniProt ID: K1C24_HUMAN
• Pfam ID: PF00038
• Sequence:
  MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAF
  GGSFGGGFGSCSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFY
  SYGGGMGGGVGDGGLFSGGEKQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYG
  PGSGDGGSGRDYSKYYSIIEDLRNQIIAATVENAGIILHIDNARLAADDFRLKYENELCL
  RQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLRKNHEEEMKNMQGSSGGEVTV
  EMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTDAGAATSAKNE
  ITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE
  TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGD
  SRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK
• Tissue Specificity: Highly expressed in keratinocytes, placenta, colon and spleen. Expressed at lower level in thymus and testis.
• KEGG Pathway:
  Estrogen sig.ling pathway (hsa04915)
  Staphylococcus aureus infection (hsa05150)
• Reactome Pathway:
  Formation of the cornified envelope (R-HSA-6809371)
  Keratinization (R-HSA-6805567)

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Keratin, type I cytoskeletal 24 (KRT24).	[1]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Keratin, type I cytoskeletal 24 (KRT24).	[2]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Keratin, type I cytoskeletal 24 (KRT24).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Keratin, type I cytoskeletal 24 (KRT24).	[4]

References

• [1] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [2] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [3] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [4] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.