Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRDE6V0)

DOT Name	Transmembrane protein 225 (TMEM225)
Gene Name	TMEM225
Related Disease	Neoplasm ( )
UniProt ID	TM225_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPE DDLKVVRIMMTSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILY HNKLKQGQSMHFSSYRITWIMYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNE CKESENSIEDISLPECTAMPRSIVRAHTVNSLNKKVQTRHVTWAL
Function	Probably inhibits protein phosphatase 1 (PP1) in sperm via binding to catalytic subunit PPP1CC.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Transmembrane protein 225 (TMEM225).	[2]
------------------------------------------------------------------------------------

References

1	Expression analysis of a panel of cancer-testis antigens in bladder cancer.Per Med. 2018 Nov;15(6):511-520. doi: 10.2217/pme-2018-0049. Epub 2018 Oct 26.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.