Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRDJ0BJ)

• DOT Name: Protein CREG2 (CREG2)
• Synonyms: Cellular repressor of E1A-stimulated genes 2
• Gene Name: CREG2
• UniProt ID: CREG2_HUMAN
• Pfam ID: PF13883
• Sequence:
  MSVRRGRRPARPGTRLSWLLCCSALLSPAAGYVIVSSVSWAVTNEVDEELDSASTEEAMP
  ALLEDSGSIWQQSFPASAHKEDAHLRPRAGAARARPPPAPPGMFSYRREGGQTASAPPGP
  RLRAATARSLAHASVWGCLATVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDP
  VVADLMKNPMASLMLPESEGEFCRKNIVDPEDPRCVQLTLTGQMIAVSPEEVEFAKQAMF
  SRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVPRKA
• Tissue Specificity: Brain specific mainly in the limbic system and faintly in the spinal cord but not in cerebellum.

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	Protein CREG2 (CREG2) affects the response to substance of 2-tert-butylbenzene-1,4-diol.	[6]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin affects the expression of Protein CREG2 (CREG2).	[1]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein CREG2 (CREG2).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein CREG2 (CREG2).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Protein CREG2 (CREG2).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein CREG2 (CREG2).	[4]

References

• [1] Molecular characterization of a toxicological tipping point during human stem cell differentiation. Reprod Toxicol. 2020 Jan;91:1-13. doi: 10.1016/j.reprotox.2019.10.001. Epub 2019 Oct 7.
• [2] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [3] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [6] Population-based in vitro hazard and concentration-response assessment of chemicals: the 1000 genomes high-throughput screening study. Environ Health Perspect. 2015 May;123(5):458-66. doi: 10.1289/ehp.1408775. Epub 2015 Jan 13.