Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTROSU7Z)

• DOT Name: Extracellular glycoprotein lacritin (LACRT)
• Gene Name: LACRT
• Related Disease:
  Blepharitis
  Breast neoplasm
  Graves disease
• UniProt ID: LACRT_HUMAN
• Sequence:
  MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTA
  QETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENG
  SEFAQKLLKKFSLLKPWA
• Function: Modulates secretion by lacrimal acinar cells.
• Tissue Specificity: Expressed in secretory granules of many acinar cells in lacrimal gland and in scattered acinar cells of salivary glands.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Blepharitis	DISXQGF5	Strong	Altered Expression	[1]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[2]
Graves disease	DISU4KOQ	Strong	Biomarker	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Extracellular glycoprotein lacritin (LACRT).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Extracellular glycoprotein lacritin (LACRT).	[5]

References

• [1] Comparative analysis of the tear protein expression in blepharitis patients using two-dimensional electrophoresis.J Proteome Res. 2005 May-Jun;4(3):719-24. doi: 10.1021/pr0498133.
• [2] Expression of a novel lacrimal gland gene lacritin in human breast tissues.J Cancer Res Clin Oncol. 2003 Dec;129(12):735-6. doi: 10.1007/s00432-003-0514-y. Epub 2003 Oct 22.
• [3] Establishment of a tear protein biomarker panel differentiating between Graves' disease with or without orbitopathy.PLoS One. 2017 Apr 18;12(4):e0175274. doi: 10.1371/journal.pone.0175274. eCollection 2017.
• [4] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.