Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRPOQGK)

• DOT Name: Killer cell immunoglobulin-like receptor 2DS1 (KIR2DS1)
• Synonyms: CD158 antigen-like family member H; MHC class I NK cell receptor Eb6 ActI; CD antigen CD158h
• Gene Name: KIR2DS1
• UniProt ID: KI2S1_HUMAN
• Pfam ID: PF00047
• Sequence:
  MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
  HREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
  VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGT
  FQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
  PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
  VSYA
• Function: Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.
• Tissue Specificity: Expressed by NK cells.
• KEGG Pathway:
  Antigen processing and presentation (hsa04612)
  .tural killer cell mediated cytotoxicity (hsa04650)
• Reactome Pathway:
  DAP12 interactions (R-HSA-2172127)
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Killer cell immunoglobulin-like receptor 2DS1 (KIR2DS1).	[1]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Killer cell immunoglobulin-like receptor 2DS1 (KIR2DS1).	[2]

References

• [1] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [2] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.