Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRWKIYY)

• DOT Name: Pyrin domain-containing protein 2 (PYDC2)
• Synonyms: Pyrin-only protein 2; cellular POP2; cPOP2
• Gene Name: PYDC2
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Bacterial infection
• UniProt ID: PYDC2_HUMAN
• Pfam ID: PF02758
• Sequence:
  MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFT
  SHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPP
• Function: May play a role in innate immunity by disrupting the interaction between PYCARD and NLRP3, thereby regulating the NLRP3 inflammasome. May also inhibit NF-kappa-B signaling distally by affecting the nuclear accumulation of RELA.
• Tissue Specificity: Predominantly expressed in peripheral blood. Weakly expressed in testis.
• KEGG Pathway: NOD-like receptor sig.ling pathway (hsa04621)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Strong	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[1]
Bacterial infection	DIS5QJ9S	moderate	Biomarker	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pyrin domain-containing protein 2 (PYDC2).	[3]

References

• [1] Novel biomarkers for prostate cancer including noncoding transcripts.Am J Pathol. 2009 Dec;175(6):2264-76. doi: 10.2353/ajpath.2009.080868. Epub 2009 Nov 5.
• [2] Pyrin-only protein 2 limits inflammation but improves protection against bacteria.Nat Commun. 2017 Jun 5;8:15564. doi: 10.1038/ncomms15564.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.