Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRYBS9N)

DOT Name	RING finger protein 148 (RNF148)
Gene Name	RNF148
UniProt ID	RN148_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF02225 ; PF13639
Sequence	MSFLRITPSTHSSVSSGLLRLSIFLLLSFPDSNGKAIWTAHLNITFQVGNEITSELGESG VFGNHSPLERVSGVVALPEGWNQNACHPLTNFSRPKQADSWLALIERGGCTFTHKINVAA EKGANGVIIYNYQGTGSKVFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVG RMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQLQ LRVLKEGDEELDLNEDNCVVCFDTYKPQDVVRILTCKHFFHKACIDPWLLAHRTCPMCKC DILKT
Tissue Specificity	Abundantly expressed in testis and slightly in pancreas. Mainly present in the interstitial cells of testicular tissues.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Marinol	DM70IK5	Approved	Marinol decreases the expression of RING finger protein 148 (RNF148).	[1]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of RING finger protein 148 (RNF148).	[2]
------------------------------------------------------------------------------------

References

1	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
2	LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.