Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS7B2ZB)

• DOT Name: Olfactory receptor 10J1 (OR10J1)
• Synonyms: Olfactory receptor OR1-26; Olfactory receptor-like protein HGMP07J
• Gene Name: OR10J1
• UniProt ID: O10J1_HUMAN
• Pfam ID: PF13853
• Sequence:
  MLLCFRFGNQSMKRENFTLITDFVFQGFSSFHEQQITLFGVFLALYILTLAGNIIIVTII
  RMDLHLHTPMYFFLSMLSTSETVYTLVILPRMLSSLVGMSQPISLAGCATQMFFFVTFGI
  TNCFLLTAMGYDRYVAICNPLRYMVIMNKRLRIQLVLGACSIGLIVAITQVTSVFRLPFC
  ARKVPHFFCDIRPVMKLSCIDTTVNEILTLIISVLVLVVPMGLVFISYVLIISTILKIAS
  VEGRKKAFATCASHLTVVIVHYSCASIAYLKPKSENTREHDQLISVTYTVITPLLNPVVY
  TLRNKEVKDALCRAVGGKFS
• Function: Odorant receptor.
• KEGG Pathway: Olfactory transduction (hsa04740)
• Reactome Pathway: Expression and translocation of olfactory receptors (R-HSA-9752946)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Olfactory receptor 10J1 (OR10J1).	[1]
Testosterone Undecanoate	DMZO10Y	Approved	Testosterone Undecanoate increases the expression of Olfactory receptor 10J1 (OR10J1).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Olfactory receptor 10J1 (OR10J1).	[3]

References

• [1] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [2] Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.