Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS80FOD)

DOT Name Unconventional myosin-Ia (MYO1A)
Synonyms Brush border myosin I; BBM-I; BBMI; Myosin I heavy chain; MIHC
Gene Name MYO1A
Related Disease
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Charcot marie tooth disease ( )
Intestinal neoplasm ( )
Neoplasm ( )
Malignant pleural mesothelioma ( )
Nonsyndromic genetic hearing loss ( )
UniProt ID
MYO1A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00612 ; PF00063 ; PF06017
Sequence
MPLLEGSVGVEDLVLLEPLVEESLLKNLQLRYENKEIYTYIGNVVISVNPYQQLPIYGPE
FIAKYQDYTFYELKPHIYALANVAYQSLRDRDRDQCILITGESGSGKTEASKLVMSYVAA
VCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITN
YLLEKSRLVKQLKGERNFHIFYQLLAGADEQLLKALKLERDTTGYAYLNHEVSRVDGMDD
ASSFRAVQSAMAVIGFSEEEIRQVLEVTSMVLKLGNVLVADEFQASGIPASGIRDGRGVR
EIGEMVGLNSEEVERALCSRTMETAKEKVVTALNVMQAQYARDALAKNIYSRLFDWIVNR
INESIKVGIGEKKKVMGVLDIYGFEILEDNSFEQFVINYCNEKLQQVFIEMTLKEEQEEY
KREGIPWTKVDYFDNGIICKLIEHNQRGILAMLDEECLRPGVVSDSTFLAKLNQLFSKHG
HYESKVTQNAQRQYDHTMGLSCFRICHYAGKVTYNVTSFIDKNNDLLFRDLLQAMWKAQH
PLLRSLFPEGNPKQASLKRPPTAGAQFKSSVAILMKNLYSKSPNYIRCIKPNEHQQRGQF
SSDLVATQARYLGLLENVRVRRAGYAHRQGYGPFLERYRLLSRSTWPHWNGGDREGVEKV
LGELSMSSGELAFGKTKIFIRSPKTLFYLEEQRRLRLQQLATLIQKIYRGWRCRTHYQLM
RKSQILISSWFRGNMQKKCYGKIKASVLLIQAFVRGWKARKNYRKYFRSEAALTLADFIY
KSMVQKFLLGLKNNLPSTNVLDKTWPAAPYKCLSTANQELQQLFYQWKCKRFRDQLSPKQ
VEILREKLCASELFKGKKASYPQSVPIPFCGDYIGLQGNPKLQKLKGGEEGPVLMAEAVK
KVNRGNGKTSSRILLLTKGHVILTDTKKSQAKIVIGLDNVAGVSVTSLKDGLFSLHLSEM
SSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGP
AGGDNSKLRYKKKGSHCLEVTVQ
Function Involved in directing the movement of organelles along actin filaments.
KEGG Pathway
Motor proteins (hsa04814 )
Pathogenic Escherichia coli infection (hsa05130 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colon cancer DISVC52G Definitive Posttranslational Modification [1]
Colon carcinoma DISJYKUO Definitive Posttranslational Modification [1]
Colorectal carcinoma DIS5PYL0 Definitive Biomarker [1]
Colorectal neoplasm DISR1UCN Definitive Posttranslational Modification [1]
Charcot marie tooth disease DIS3BT2L Strong Genetic Variation [2]
Intestinal neoplasm DISK0GUH Strong Altered Expression [3]
Neoplasm DISZKGEW Strong Altered Expression [3]
Malignant pleural mesothelioma DIST2R60 Limited Altered Expression [4]
Nonsyndromic genetic hearing loss DISZX61P Refuted Autosomal dominant [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Unconventional myosin-Ia (MYO1A). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Unconventional myosin-Ia (MYO1A). [8]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Unconventional myosin-Ia (MYO1A). [7]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde decreases the expression of Unconventional myosin-Ia (MYO1A). [9]
------------------------------------------------------------------------------------

References

1 Brush border myosin Ia has tumor suppressor activity in the intestine.Proc Natl Acad Sci U S A. 2012 Jan 31;109(5):1530-5. doi: 10.1073/pnas.1108411109. Epub 2012 Jan 18.
2 Variants in the genes DCTN2, DNAH10, LRIG3, and MYO1A are associated with intermediate Charcot-Marie-Tooth disease in a Norwegian family.Acta Neurol Scand. 2016 Jul;134(1):67-75. doi: 10.1111/ane.12515. Epub 2015 Oct 12.
3 Brush border myosin Ia inactivation in gastric but not endometrial tumors.Int J Cancer. 2013 Apr 15;132(8):1790-9. doi: 10.1002/ijc.27856. Epub 2012 Oct 20.
4 Inhibitor of apoptosis protein-1 promotes tumor cell survival in mesothelioma.Carcinogenesis. 2002 Jun;23(6):1017-24. doi: 10.1093/carcin/23.6.1017.
5 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
6 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.