Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSJISGF)

• DOT Name: CKLF-like MARVEL transmembrane domain-containing protein 2 (CMTM2)
• Synonyms: Chemokine-like factor superfamily member 2
• Gene Name: CMTM2
• Related Disease:
  Colorectal carcinoma
  Glioblastoma multiforme
  Juvenile idiopathic arthritis
  Sezary syndrome
  Neoplasm
• UniProt ID: CKLF2_HUMAN
• Sequence:
  MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKH
  EVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITM
  EISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLL
  AVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKP
  PGPAKGKK
• Tissue Specificity: Highly expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[2]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[3]
Sezary syndrome	DISFMTC7	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	moderate	Biomarker	[5]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of CKLF-like MARVEL transmembrane domain-containing protein 2 (CMTM2).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of CKLF-like MARVEL transmembrane domain-containing protein 2 (CMTM2).	[7]

References

• [1] Genome-wide analysis of aberrant DNA methylation for identification of potential biomarkers in colorectal cancer patients.Asian Pac J Cancer Prev. 2012;13(5):1917-21. doi: 10.7314/apjcp.2012.13.5.1917.
• [2] Systematic investigation of CMTM family genes suggests relevance to glioblastoma pathogenesis and CMTM1 and CMTM3 as priority targets.Genes Chromosomes Cancer. 2015 Jul;54(7):433-43. doi: 10.1002/gcc.22255. Epub 2015 Apr 30.
• [3] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [4] Epigenomic Analysis of Szary Syndrome Defines Patterns of Aberrant DNA Methylation and Identifies DiagnosticMarkers.J Invest Dermatol. 2016 Sep;136(9):1876-1884. doi: 10.1016/j.jid.2016.03.042. Epub 2016 Apr 23.
• [5] Chemokine and Chemokine Receptor Profiles in Metastatic Salivary Adenoid Cystic Carcinoma.Anticancer Res. 2016 Aug;36(8):4013-8.
• [6] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.