Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSOLZWA)

DOT Name	Olfactory receptor 2J3 (OR2J3)
Synonyms	Hs6M1-3; Olfactory receptor OR6-16; OR6-6; Olfactory receptor 6-6
Gene Name	OR2J3
Related Disease	Non-small-cell lung cancer ( )
UniProt ID	OR2J3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13853
Sequence	MNDDGKVNASSEGYFILVGFSNWPHLEVVIFVVVLIFYLMTLIGNLFIIILSYLDSHLHT PMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVV MSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHF FCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVRAVLRMQSTTGLQKV FGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVV RGAVKRLMGWE
Function	Odorant receptor involved in the detection of the flavor compound cis-3-hexen-1-ol (C3HEX), a compound typically described as 'green grassy' or the smell of 'cut grass'.
KEGG Pathway	Olfactory transduction (hsa04740 )
Reactome Pathway	Expression and translocation of olfactory receptors (R-HSA-9752946 ) Olfactory Signaling Pathway (R-HSA-381753 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Olfactory receptor 2J3 (OR2J3).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Olfactory receptor 2J3 (OR2J3).	[3]
------------------------------------------------------------------------------------

References

1	Helional-induced activation of human olfactory receptor 2J3 promotes apoptosis and inhibits proliferation in a non-small-cell lung cancer cell line.Eur J Cell Biol. 2017 Jan;96(1):34-46. doi: 10.1016/j.ejcb.2016.11.004. Epub 2016 Dec 5.
2	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.