Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTTU3FKC)
| DOT Name | Mitochondrial substrate carrier family protein ancA (ancA?) | ||||
|---|---|---|---|---|---|
| Synonyms | ADP,ATP carrier protein; ADP/ATP translocase; Adenine nucleotide translocator; ANT | ||||
| Gene Name | ancA? | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MSNQKKNDVSSFVKDSLIGGTAGGVSKTIVAPIERVKLLLQVQSASTQIAADKQYKGIVD
CFVRVSKEQGVISLWRGNLANVIRYFPTQALNFAFKDKYKKFFVRHTAKENPTKFFIGNL LSGGAAGATSLLFVYPLDFARTRLAADVGTGSARQFTGLGNCISSIYKRDGLIGLYRGFG VSVGGIFVYRAAFFGGYDTAKGILLGENNKKASFWASWGIAQVVTTIAGVVSYPFDTVRR RMMMQAGRADILYSSTWDCWVKIATREGPTAFFKGALSNAIRGSGGALVLVIYDEIQKLM GFEGGVGSE |
||||
| Function |
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||
