Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU2YGKP)

• DOT Name: Interferon-induced transmembrane protein 10 (IFITM10)
• Synonyms: Dispanin subfamily A member 3; DSPA3
• Gene Name: IFITM10
• Related Disease:
  Breast cancer
  Breast carcinoma
• UniProt ID: IFM10_HUMAN
• Pfam ID: PF04505
• Sequence:
  MREGKRGPPCILSFRGTLERVEAQWELEAQGPGQCPAPLGDPASTTDGAQEARVPLDGAF
  WIPRPPAGSPKGCFACVSKPPALQAPAAPAPEPSASPPMAPTLFPMESKSSKTDSVRAAG
  APPACKHLAEKKTMTNPTTVIEVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKV
  RDKKLLNDLNGAVEDAKTARLFNITSSALAASCIILVFIFLRYPLTDY

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Limited	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Interferon-induced transmembrane protein 10 (IFITM10).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interferon-induced transmembrane protein 10 (IFITM10).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Interferon-induced transmembrane protein 10 (IFITM10).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Interferon-induced transmembrane protein 10 (IFITM10).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Interferon-induced transmembrane protein 10 (IFITM10).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Interferon-induced transmembrane protein 10 (IFITM10).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Interferon-induced transmembrane protein 10 (IFITM10).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Interferon-induced transmembrane protein 10 (IFITM10).	[9]

References

• [1] Recurrent read-through fusion transcripts in breast cancer.Breast Cancer Res Treat. 2014 Jul;146(2):287-97. doi: 10.1007/s10549-014-3019-2. Epub 2014 Jun 15.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [5] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.