Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU4GEMD)

DOT Name	Gamma-crystallin B (CRYGB)
Synonyms	Gamma-B-crystallin; Gamma-crystallin 1-2
Gene Name	CRYGB
Related Disease	Cataract ( ) Early-onset anterior polar cataract ( ) Early-onset lamellar cataract ( ) Total early-onset cataract ( ) Cataract 39 multiple types ( )
UniProt ID	CRGB_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2JDF; 2JDG
Pfam ID	PF00030
Sequence	MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRR GEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLT EIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY
Function	Crystallins are the dominant structural components of the vertebrate eye lens.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cataract	DISUD7SL	Strong	Genetic Variation	[1]
Early-onset anterior polar cataract	DISTOPIY	Supportive	Autosomal dominant	[2]
Early-onset lamellar cataract	DISR7WXX	Supportive	Autosomal dominant	[2]
Total early-onset cataract	DISACMEZ	Supportive	Autosomal dominant	[2]
Cataract 39 multiple types	DISBI7H9	Limited	Autosomal dominant	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Gamma-crystallin B (CRYGB).	[3]
------------------------------------------------------------------------------------

References

1	Polymorphisms of the gamma crystallin A and B genes among Indian patients with pediatric cataract. J Postgrad Med. 2011 Jul-Sep;57(3):201-5. doi: 10.4103/0022-3859.85205.
2	Novel crystallin gamma B mutations in a Kuwaiti family with autosomal dominant congenital cataracts reveal genetic and clinical heterogeneity. Mol Vis. 2012;18:2931-6. Epub 2012 Dec 9.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.