General Information of Drug Off-Target (DOT) (ID: OTU5Z3YK)

DOT Name Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8)
Synonyms C1q/TNF-related protein 8; CTRP8
Gene Name C1QTNF8
Related Disease
Adult glioblastoma ( )
Brain neoplasm ( )
Glioblastoma multiforme ( )
Type-1 diabetes ( )
UniProt ID
C1QT8_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00386 ; PF01391
Sequence
MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVR
PTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFS
VGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYL
HIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYIT
FSGHLVKPAAEL
Function May play a role as ligand of RXFP1.
Tissue Specificity Expressed predominantly in lung and testis . Expressed in astrocytes .

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult glioblastoma DISVP4LU Limited Biomarker [1]
Brain neoplasm DISY3EKS Limited Biomarker [1]
Glioblastoma multiforme DISK8246 Limited Biomarker [1]
Type-1 diabetes DIS7HLUB Limited Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8). [6]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8). [4]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8). [5]
------------------------------------------------------------------------------------

References

1 C1q/TNF-related peptide 8 (CTRP8) promotes temozolomide resistance in human glioblastoma.Mol Oncol. 2018 Sep;12(9):1464-1479. doi: 10.1002/1878-0261.12349. Epub 2018 Aug 2.
2 Analysis of loss-of-function variants and 20 risk factor phenotypes in 8,554 individuals identifies loci influencing chronic disease.Nat Genet. 2015 Jun;47(6):640-2. doi: 10.1038/ng.3270. Epub 2015 Apr 27.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.