Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTU8IMIR)
DOT Name | Calcium-binding protein 5 (CABP5) | ||||
---|---|---|---|---|---|
Synonyms | CaBP5 | ||||
Gene Name | CABP5 | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTM
GYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTN GDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR |
||||
Function |
Inhibits calcium-dependent inactivation of L-type calcium channel and shifts voltage dependence of activation to more depolarized membrane potentials. Involved in the transmission of light signals. May positively regulate neurotransmitter vesicle endocytosis and exocytosis in a salt-dependent manner. May play a role in the extension and network organization of neurites.
|
||||
Tissue Specificity | Retina. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||
References