Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUMVEWE)

• DOT Name: Bublin coiled-coil protein (BBLN)
• Synonyms: UPF0184 protein C9orf16
• Gene Name: BBLN
• UniProt ID: BBLN_HUMAN
• Pfam ID: PF03670
• Sequence:
  MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELL
  ESNRQTRLEFQQQLGEAPSDASP
• Function: Essential for intermediate filament organization in intestinal cells, interacts with intermediate filament and regulates intestinal lumen morphology.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Bublin coiled-coil protein (BBLN).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Bublin coiled-coil protein (BBLN).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Bublin coiled-coil protein (BBLN).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Bublin coiled-coil protein (BBLN).	[4]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Bublin coiled-coil protein (BBLN).	[5]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Bublin coiled-coil protein (BBLN).	[6]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Bublin coiled-coil protein (BBLN).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Bublin coiled-coil protein (BBLN).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Bublin coiled-coil protein (BBLN).	[9]

References

• [1] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [2] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [6] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [7] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [8] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [9] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.