Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUOMSRP)

• DOT Name: Transcription factor Spi-C (SPIC)
• Gene Name: SPIC
• Related Disease:
  Colorectal carcinoma
  Colitis
  Non-insulin dependent diabetes
• UniProt ID: SPIC_HUMAN
• Pfam ID: PF00178
• Sequence:
  MTCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNSSCYGVLPTE
  EPVYNWRTVINSAADFYFEGNIHQSLQNITENQLVQPTLLQQKGGKGRKKLRLFEYLHES
  LYNPEMASCIQWVDKTKGIFQFVSKNKEKLAELWGKRKGNRKTMTYQKMARALRNYGRSG
  EITKIRRKLTYQFSEAILQRLSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANY
  HELNHHDC
• Function: Controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. Transcription factor that binds to the PU-box, a purine-rich DNA sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. Regulates VCAM1 gene expression.
• Tissue Specificity: Preferentially detected in fetal and adult spleen, lymph nodes and at lower levels in bone marrow and fetal liver.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Colitis	DISAF7DD	Strong	Altered Expression	[2]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Transcription factor Spi-C (SPIC).	[4]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Transcription factor Spi-C (SPIC).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transcription factor Spi-C (SPIC).	[5]

References

• [1] Analysis of select members of the E26 (ETS) transcription factors family in colorectal cancer.Virchows Arch. 2011 Apr;458(4):421-30. doi: 10.1007/s00428-011-1053-6. Epub 2011 Feb 12.
• [2] Heme ameliorates dextran sodium sulfate-induced colitis through providing intestinal macrophages with noninflammatory profiles.Proc Natl Acad Sci U S A. 2018 Aug 14;115(33):8418-8423. doi: 10.1073/pnas.1808426115. Epub 2018 Jul 30.
• [3] The Effects of Soy Protein and Cocoa With or Without Isoflavones on Glycemic Control in Type 2 Diabetes. A Double-Blind, Randomized, Placebo-Controlled Study.Front Endocrinol (Lausanne). 2019 May 9;10:296. doi: 10.3389/fendo.2019.00296. eCollection 2019.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.