Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTUZZ67L)
| DOT Name | Heat shock protein beta-1 (HSPB1) | ||||
|---|---|---|---|---|---|
| Synonyms | HspB1; 25 kDa IAP; Actin polymerization inhibitor; Heat shock 25 kDa protein; HSP 25; Heat shock 27 kDa protein; HSP 27 | ||||
| Gene Name | HSPB1 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MAERRVPFTFLTSPSWEPFRDWYHGSRLFDQSFGMPHIPEDWYKWPSGSAWPGYFRLLPS
ESALLPAPGSPYGRALSELSSGISEIRQSADSWKVTLDVNHFAPEELVVKTKDNIVEITG KHEEKQDEHGFISRCFTRKYTLPPGVEATAVRSSLSPDGMLTVEAPLPKPAIQSSEITIP VTVEAKKEEPAKK |
||||
| Function | Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. | ||||
| Tissue Specificity | Smooth, cardiac and skeletal muscle, hardly detectable in fibroblasts or focal contacts. | ||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||
