Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV4GV28)

• DOT Name: Noncompact myelin-associated protein (NCMAP)
• Synonyms: Myelin protein of 11 kDa; MP11
• Gene Name: NCMAP
• UniProt ID: NCMAP_HUMAN
• Sequence:
  MTTATPLGDTTFFSLNMTTRGEDFLYKSSGAIVAAVVVVVIIIFTVVLILLKMYNRKMRT
  RRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVETR
• Function: Plays a role in myelin formation.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Noncompact myelin-associated protein (NCMAP).	[1]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Noncompact myelin-associated protein (NCMAP).	[2]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Noncompact myelin-associated protein (NCMAP).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Noncompact myelin-associated protein (NCMAP).	[4]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [3] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.