Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV9N4KM)

DOT Name	Cancer/testis antigen 62 (CT62)
Synonyms	CT62
Gene Name	CT62
Related Disease	Breast cancer ( ) Breast carcinoma ( )
UniProt ID	CT62_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MMHTTSYRRLSPPHLTDQPSAYSHTHRTFSHFSCGSQPAAQRLHVELWNADLQSEFLCPC LGLTLYLTCNPQLGKRKFCSHSSEDMSKMVSRRNVKDSHEVSGSLQATLQVISFSFPFLL HTCSHPLSHPTSGQRR
Tissue Specificity	Testis specific. Expressed in cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Breast cancer	DIS7DPX1	Limited	Biomarker	[1]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorothiazide	DMLHESP	Approved	Cancer/testis antigen 62 (CT62) increases the Metabolic disorder ADR of Chlorothiazide.	[2]
------------------------------------------------------------------------------------

References

1	ACE: A Workbench Using Evolutionary Genetic Algorithms for Analyzing Association in TCGA.Cancer Res. 2019 Apr 15;79(8):2072-2075. doi: 10.1158/0008-5472.CAN-18-1976. Epub 2019 Feb 13.
2	Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.