Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTVDWM2T)
| DOT Name | Type III endosome membrane protein TEMP (C1ORF210) | ||||
|---|---|---|---|---|---|
| Synonyms | TEMP | ||||
| Gene Name | C1ORF210 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRY
HASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHFSL |
||||
| Function | May be involved in membrane trafficking between endosomes and plasma membrane. | ||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||
References
