Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVKMIM4)

DOT Name Odorant-binding protein 2b (OBP2B)
Synonyms Odorant-binding protein IIb; OBPIIb
Gene Name OBP2B
UniProt ID
OBP2B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00061
Sequence
MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGG
KLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHG
GLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH
Function Probably binds and transports small hydrophobic volatile molecules.
Tissue Specificity Strongly expressed in genital sphere organs such as the prostate and mammary glands.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Odorant-binding protein 2b (OBP2B). [1]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Odorant-binding protein 2b (OBP2B). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Odorant-binding protein 2b (OBP2B). [3]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Odorant-binding protein 2b (OBP2B). [4]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Odorant-binding protein 2b (OBP2B). [5]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
5 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.