Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVP8PD1)

DOT Name	Probable G-protein coupled receptor 21 (GPR21)
Gene Name	GPR21
Related Disease	Non-insulin dependent diabetes ( )
UniProt ID	GPR21_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8HIX; 8HJ0; 8HJ2; 8HMV
Pfam ID	PF00001
Sequence	MNSTLDGNQSSHPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLN HHTTSYFIQTMAYADLFVGVSCVVPSLSLLHHPLPVEESLTCQIFGFVVSVLKSVSMASL ACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQW CAESWHTDSYFTLFIVMMLYAPAALIVCFTYFNIFRICQQHTKDISERQARFSSQSGETG EVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGHSNRFASFLTTWLAISNSFCN CVIYSLSNSVFQRGLKRLSGAMCTSCASQTTANDPYTVRSKGPLNGCHI
Function	Orphan receptor.
Tissue Specificity	Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus, hippocampus.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Probable G-protein coupled receptor 21 (GPR21).	[2]
------------------------------------------------------------------------------------

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Probable G-protein coupled receptor 21 (GPR21).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Probable G-protein coupled receptor 21 (GPR21).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Probable G-protein coupled receptor 21 (GPR21).	[5]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Probable G-protein coupled receptor 21 (GPR21).	[6]
------------------------------------------------------------------------------------

References

1	Regulating the effects of GPR21, a novel target for type 2 diabetes.Sci Rep. 2016 May 31;6:27002. doi: 10.1038/srep27002.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
4	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
5	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
6	Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.