Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVPS7KK)

DOT Name	Solute carrier family 35 member G3 (SLC35G3)
Synonyms	Acyl-malonyl-condensing enzyme 1; Transmembrane protein 21A
Gene Name	SLC35G3
UniProt ID	S35G3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00892
Sequence	MAGSHPYFNQPDSTHPSPPSAPPSLRWYQRCQPSDATSGLLVALLGGGLPAGFVGPLSRM AYQASNLPSLELLIWRCLFHLPIALLLKLRGDPLLGTPDIRSRAFFCALLNILSIGCAYS AVQVVPAGNAATVRKGSSTVCSAVLTLCLESQGLSGYDWCGLLGCILGLIIIVGPGLWTL QEGTTGVYTALGYVEAFLGGLALSLRLLVYRSLHFPPCLPTVAFLSGLVGLLGSVPGLFV LQAPVLPSDLLSWSCVGAVGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYM LHETVAPSDIVAAGVVLGSIAIITAQNLSCERTGRVEE
Tissue Specificity	Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Solute carrier family 35 member G3 (SLC35G3).	[1]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Solute carrier family 35 member G3 (SLC35G3).	[2]
------------------------------------------------------------------------------------

References

1	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
2	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.