| DOT Name |
Calcineurin subunit B type 2 (PPP3R2)
|
| Synonyms |
Calcineurin B-like protein; CBLP; Calcineurin BII; CNBII; PPP3R1-like; Protein phosphatase 2B regulatory subunit 2; Protein phosphatase 3 regulatory subunit B beta isoform |
| Gene Name |
PPP3R2
|
| Related Disease |
- Osteoarthritis ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVID VFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
|
| Function |
Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. |
| Tissue Specificity |
Testis-specific. |
| KEGG Pathway |
- MAPK sig.ling pathway (hsa04010 )
- Calcium sig.ling pathway (hsa04020 )
- cGMP-PKG sig.ling pathway (hsa04022 )
- Oocyte meiosis (hsa04114 )
- Cellular senescence (hsa04218 )
- Wnt sig.ling pathway (hsa04310 )
- Axon guidance (hsa04360 )
- VEGF sig.ling pathway (hsa04370 )
- Osteoclast differentiation (hsa04380 )
- C-type lectin receptor sig.ling pathway (hsa04625 )
- .tural killer cell mediated cytotoxicity (hsa04650 )
- Th1 and Th2 cell differentiation (hsa04658 )
- Th17 cell differentiation (hsa04659 )
- T cell receptor sig.ling pathway (hsa04660 )
- B cell receptor sig.ling pathway (hsa04662 )
- Long-term potentiation (hsa04720 )
- Glutamatergic sy.pse (hsa04724 )
- Oxytocin sig.ling pathway (hsa04921 )
- Glucagon sig.ling pathway (hsa04922 )
- Renin secretion (hsa04924 )
- Alzheimer disease (hsa05010 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Amphetamine addiction (hsa05031 )
- Tuberculosis (hsa05152 )
- Human cytomegalovirus infection (hsa05163 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
- Lipid and atherosclerosis (hsa05417 )
|
|
|
|
|
|
|